PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G165000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 390aa    MW: 40324.1 Da    PI: 8.9506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G165000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-1679124147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.6G165000.1.p  79 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 124
                         899*****************************.***********996 PP

2Myb_DNA-binding52.11.5e-16132174246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Sevir.6G165000.1.p 132 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 174
                         689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7874125IPR017930Myb domain
SMARTSM007176.1E-1478127IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-2779172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-2680132IPR009057Homeodomain-like
CDDcd001679.24E-1382123No hitNo description
PfamPF139219.8E-1682142No hitNo description
PROSITE profilePS5129424.91126180IPR017930Myb domain
SMARTSM007174.9E-13130178IPR001005SANT/Myb domain
CDDcd001671.90E-10133173No hitNo description
Gene3DG3DSA:1.10.10.605.0E-20133179IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MPCSSPAAPA WLLRVATAAA AADQASSSTS SKGGGRVLTA GTTTMDTGAT AAGGCGGGNA  60
SAIDHQESSS SGQSRLAARG HWRPAEDAKL RELVALYGPQ NWNLIAEKLD GRSGKSCRLR  120
WFNQLDPRIS KRPFSDEEEE RLMAAHRFYG NKWAMIARLF PGRTDNAVKN HWHVIMARKY  180
REQSTAYRRR KLNQAVQRKL EAVAVAMPPT AGPGNAAAGG GHHHNILAAA AAAAAAHDAA  240
YGFGADPYGF SFRHYCSFPF PPGAASPEDH PPPPPPPPFC LFPGPGGAAA AHADRRLPWL  300
SSDGGSGGGR YGEPPLLLPV PGVGWIDGIS MGGGGGGHHE PHQFVLGHDA GAAAFEGTAT  360
RQGAGAHFDA AAAAAPSPAF IDFLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33791797107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973514.21e-160PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101769800
TrEMBLA0A096TRF21e-163A0A096TRF2_MAIZE; Uncharacterized protein
STRINGGRMZM2G428555_P031e-162(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-70myb domain protein 105